Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WWOX Rabbit Polyclonal Antibody (Biotin)

WWOX Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

FOR, WOX1, DEE28, EIEE28, FRA16D, SCAR12, HHCMA56, PRO0128, SDR41C1, D16S432E

UniProt

Q9NZC7

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: DDNPTKPTTRQRYDGSTTAMEILQGRDFTGKVVVVTGANSGIGFETAKSF

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

21kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_570607

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dammaradienyl acetate
380005 5 mg

Dammaradienyl acetate

Sign In for Pricing
View Details
Rabbit anti-human actinin, alpha 2 polyclonal Antibody
MBS711772-01 0.1 mL

Rabbit anti-human actinin, alpha 2 polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti-human actinin, alpha 2 polyclonal Antibody
MBS711772-02 5x 0.1 mL

Rabbit anti-human actinin, alpha 2 polyclonal Antibody

Sign In for Pricing
View Details
Lentiviral human PPP1R15B shRNA (UAS) - Lentiviral human PPP1R15B shRNA (UAS, GFP) plasmid
GTR15310933 1 Vial

Lentiviral human PPP1R15B shRNA (UAS) - Lentiviral human PPP1R15B shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
FOXA2 (HNF3B, TCF3B, Forkhead Box A2, OTTHUMP00000030409, MGC19807, OTTHUMP00000030410, Hepatic Nuclear Factor-3-beta, Hepatocyte Nuclear Factor 3, beta) (MaxLight 405)
MBS6194129-01 0.1 mL

FOXA2 (HNF3B, TCF3B, Forkhead Box A2, OTTHUMP00000030409, MGC19807, OTTHUMP00000030410, Hepatic Nuclear Factor-3-beta, Hepatocyte Nuclear Factor 3, beta) (MaxLight 405)

Sign In for Pricing
View Details
FOXA2 (HNF3B, TCF3B, Forkhead Box A2, OTTHUMP00000030409, MGC19807, OTTHUMP00000030410, Hepatic Nuclear Factor-3-beta, Hepatocyte Nuclear Factor 3, beta) (MaxLight 405)
MBS6194129-02 5x 0.1 mL

FOXA2 (HNF3B, TCF3B, Forkhead Box A2, OTTHUMP00000030409, MGC19807, OTTHUMP00000030410, Hepatic Nuclear Factor-3-beta, Hepatocyte Nuclear Factor 3, beta) (MaxLight 405)

Sign In for Pricing
View Details