Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPL12 Rabbit Polyclonal Antibody (FITC)

RPL12 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

L12

UniProt

P30050

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: ATSALAPKIGPLGLSPKKVGDDIAKATGDWKGLRITVKLTIQNRQAQIEV

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

18kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_000967

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-FoxO3a (Ser253) Polyclonal Antibody, AbBy Fluor™ 405 Conjugated
bs-3140R-BF405-01 20 µL

Phospho-FoxO3a (Ser253) Polyclonal Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
Phospho-FoxO3a (Ser253) Polyclonal Antibody, AbBy Fluor™ 405 Conjugated
bs-3140R-BF405-02 100 µL

Phospho-FoxO3a (Ser253) Polyclonal Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
DHRS7, NT (DHRS7, DHRS7A, RETSDR4, Dehydrogenase/reductase SDR family member 7, Retinal short-chain dehydrogenase/reductase 4) (MaxLight 550) discontinued
034625-ML550 100 µL

DHRS7, NT (DHRS7, DHRS7A, RETSDR4, Dehydrogenase/reductase SDR family member 7, Retinal short-chain dehydrogenase/reductase 4) (MaxLight 550) discontinued

Sign In for Pricing
View Details
Bovine Heat Shock Protein 70 Antibody (HSP-70-Ab) ELISA Kit
YP-W77238-01 48 Tests

Bovine Heat Shock Protein 70 Antibody (HSP-70-Ab) ELISA Kit

Sign In for Pricing
View Details
Bovine Heat Shock Protein 70 Antibody (HSP-70-Ab) ELISA Kit
YP-W77238-02 96 Tests

Bovine Heat Shock Protein 70 Antibody (HSP-70-Ab) ELISA Kit

Sign In for Pricing
View Details
ASXL2 (NM_018263) Human Tagged ORF Clone Lentiviral Particle
RC220364L2V 200 µL

ASXL2 (NM_018263) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details