Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NDUFS8 Rabbit Polyclonal Antibody (FITC)

NDUFS8 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

TYKY, CI-23k, CI23KD, MC1DN2

UniProt

O00217

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: CKLCEAICPAQAITIEAEPRADGSRRTTRYDIDMTKCIYCGFCQEACPVD

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

23kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_002487

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACADM (NM_000016) Human Over-expression Lysate
LC400001 20 µg

ACADM (NM_000016) Human Over-expression Lysate

Sign In for Pricing
View Details
Dual Caspase 1 and Mitochondrial Membrane Potential Assay Kit
MITCAP600-2 100 Tests

Dual Caspase 1 and Mitochondrial Membrane Potential Assay Kit

Sign In for Pricing
View Details
M6A Recombinant Rabbit monoclonal Antibody
HA750493 100 µL

M6A Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
NSE gamma (Neuron Specific Enolase, gamma) (Neuroendocrine Marker) (ENO2/1462), CF640R conjugate, 0.1mg/mL
BNC401462-100 1x 100 µL

NSE gamma (Neuron Specific Enolase, gamma) (Neuroendocrine Marker) (ENO2/1462), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TAF1B Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1A8]
TA808689BM 100 µL

TAF1B Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1A8]

Sign In for Pricing
View Details
Human TMPRSS7 activation kit by CRISPRa
GA117597 1 Kit

Human TMPRSS7 activation kit by CRISPRa

Sign In for Pricing
View Details