Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HOOK1 Rabbit Polyclonal Antibody (FITC)

HOOK1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

HK1

UniProt

Q9UJC3

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: REVFIRLQHENKMLRLQQEGSENERIEELQEQLEQKHRKMNELETEQRLS

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

80kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_056972

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MED22, NT (MED22, SURF5, Mediator of RNA polymerase II transcription subunit 22, Mediator complex subunit 22, Surfeit locus protein 5) (MaxLight 405)
MBS6319995-01 0.1 mL

MED22, NT (MED22, SURF5, Mediator of RNA polymerase II transcription subunit 22, Mediator complex subunit 22, Surfeit locus protein 5) (MaxLight 405)

Sign In for Pricing
View Details
MED22, NT (MED22, SURF5, Mediator of RNA polymerase II transcription subunit 22, Mediator complex subunit 22, Surfeit locus protein 5) (MaxLight 405)
MBS6319995-02 5x 0.1 mL

MED22, NT (MED22, SURF5, Mediator of RNA polymerase II transcription subunit 22, Mediator complex subunit 22, Surfeit locus protein 5) (MaxLight 405)

Sign In for Pricing
View Details
Mouse IL-12 Recombinant Protein Lyophilized
MBS8434149-01 0.002 mg

Mouse IL-12 Recombinant Protein Lyophilized

Sign In for Pricing
View Details
Mouse IL-12 Recombinant Protein Lyophilized
MBS8434149-02 5x 0.002 mg

Mouse IL-12 Recombinant Protein Lyophilized

Sign In for Pricing
View Details
UTF1 Antibody
orb1267150 400 μl

UTF1 Antibody

Sign In for Pricing
View Details
R 715 TFA
orb1980113-01 1 mg

R 715 TFA

Sign In for Pricing
View Details