Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FIS1 Rabbit Polyclonal Antibody (FITC)

FIS1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

TTC11, CGI-135

UniProt

Q9Y3D6

Immunogen

The immunogen is a synthetic peptide directed towards the following sequence LKYVRGLLQTEPQNNQAKELERLIDKAMKKDGLVGMAIVGGMALGVAGLA

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LKYVRGLLQTEPQNNQAKELERLIDKAMKKDGLVGMAIVGGMALGVAGLA

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

17 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat

NCBI Accession Number

NP_057152

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZFP14, NT (ZFP14, KIAA1559, ZNF531, Zinc finger protein 14 homolog, Zinc finger protein 531) (MaxLight 550)
MBS6365124-01 0.1 mL

ZFP14, NT (ZFP14, KIAA1559, ZNF531, Zinc finger protein 14 homolog, Zinc finger protein 531) (MaxLight 550)

Sign In for Pricing
View Details
ZFP14, NT (ZFP14, KIAA1559, ZNF531, Zinc finger protein 14 homolog, Zinc finger protein 531) (MaxLight 550)
MBS6365124-02 5x 0.1 mL

ZFP14, NT (ZFP14, KIAA1559, ZNF531, Zinc finger protein 14 homolog, Zinc finger protein 531) (MaxLight 550)

Sign In for Pricing
View Details
RAB1B, CT (RAB1B, Ras-related protein Rab-1B) (APC) discontinued
040740-APC 200 µL

RAB1B, CT (RAB1B, Ras-related protein Rab-1B) (APC) discontinued

Sign In for Pricing
View Details
Rabbit anti-human papillomavirus type 16 Protein E6 polyclonal Antibody, FITC
MBS1489768-01 0.05 mg

Rabbit anti-human papillomavirus type 16 Protein E6 polyclonal Antibody, FITC

Sign In for Pricing
View Details
Rabbit anti-human papillomavirus type 16 Protein E6 polyclonal Antibody, FITC
MBS1489768-02 0.1 mg

Rabbit anti-human papillomavirus type 16 Protein E6 polyclonal Antibody, FITC

Sign In for Pricing
View Details
Rabbit anti-human papillomavirus type 16 Protein E6 polyclonal Antibody, FITC
MBS1489768-03 5x 0.1 mg

Rabbit anti-human papillomavirus type 16 Protein E6 polyclonal Antibody, FITC

Sign In for Pricing
View Details