Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

APOM Rabbit Polyclonal Antibody (FITC)

APOM Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

G3a, NG20, apo-M, HSPC336

UniProt

O95445

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: QGYQRFLLYNRSPHPPEKCVEEFKSLTSCLDSKAFLLTPRNQEACELSNN

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

21kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_061974

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lsm16 3'UTR GFP Stable Cell Line
TU262634 1.0 mL

Lsm16 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
TTYH2 Protein Vector (Human) (pPB-N-His)
PV059414 500 ng

TTYH2 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
ITFG2 (Integrin-alpha FG-GAP Repeat-containing Protein 2, MDS028) (MaxLight 750)
MBS6233829-01 0.1 mL

ITFG2 (Integrin-alpha FG-GAP Repeat-containing Protein 2, MDS028) (MaxLight 750)

Sign In for Pricing
View Details
ITFG2 (Integrin-alpha FG-GAP Repeat-containing Protein 2, MDS028) (MaxLight 750)
MBS6233829-02 5x 0.1 mL

ITFG2 (Integrin-alpha FG-GAP Repeat-containing Protein 2, MDS028) (MaxLight 750)

Sign In for Pricing
View Details
Mouse Chorionic Gonadotrophin ELISA Kit
MBS3805692-01 48 Well

Mouse Chorionic Gonadotrophin ELISA Kit

Sign In for Pricing
View Details
Mouse Chorionic Gonadotrophin ELISA Kit
MBS3805692-02 96 Well

Mouse Chorionic Gonadotrophin ELISA Kit

Sign In for Pricing
View Details