Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAB1B Rabbit Polyclonal Antibody (FITC)

RAB1B Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

Q9H0U4

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: TSAKNATNVEQAFMTMAAEIKKRMGPGAASGGERPNLKIDSTPVKPAGGG

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

22kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_112243

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hamster Leucine Rich Repeat And Fibronectin Type-III Domain-Containing Protein 3 (LRFN3) ELISA Kit
MBS9390640-01 48 Well

Hamster Leucine Rich Repeat And Fibronectin Type-III Domain-Containing Protein 3 (LRFN3) ELISA Kit

Sign In for Pricing
View Details
Hamster Leucine Rich Repeat And Fibronectin Type-III Domain-Containing Protein 3 (LRFN3) ELISA Kit
MBS9390640-02 96 Well

Hamster Leucine Rich Repeat And Fibronectin Type-III Domain-Containing Protein 3 (LRFN3) ELISA Kit

Sign In for Pricing
View Details
Hamster Leucine Rich Repeat And Fibronectin Type-III Domain-Containing Protein 3 (LRFN3) ELISA Kit
MBS9390640-03 5x 96 Well

Hamster Leucine Rich Repeat And Fibronectin Type-III Domain-Containing Protein 3 (LRFN3) ELISA Kit

Sign In for Pricing
View Details
Hamster Leucine Rich Repeat And Fibronectin Type-III Domain-Containing Protein 3 (LRFN3) ELISA Kit
MBS9390640-04 10x 96 Well

Hamster Leucine Rich Repeat And Fibronectin Type-III Domain-Containing Protein 3 (LRFN3) ELISA Kit

Sign In for Pricing
View Details
Canine Pregnancy-associated glycoprotein (PAG) ELISA Kit
YP-W76695-01 48 Tests

Canine Pregnancy-associated glycoprotein (PAG) ELISA Kit

Sign In for Pricing
View Details
Canine Pregnancy-associated glycoprotein (PAG) ELISA Kit
YP-W76695-02 96 Tests

Canine Pregnancy-associated glycoprotein (PAG) ELISA Kit

Sign In for Pricing
View Details