Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NDUFS4 Rabbit Polyclonal Antibody (FITC)

NDUFS4 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

AQDQ, CI-18, MC1DN1, CI-AQDQ, CI-18 kDa

UniProt

O43181

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: FVPARNNMQSGVNNTKKWKMEFDTRERWENPLMGWASTADPLSNMVLTFS

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

20kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_002486

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Liver
CS800906 5x 5 µm

Tissue FFPE Sections, Liver

Sign In for Pricing
View Details
AF 532 NHS Ester
CHM-114-5mg 5 mg

AF 532 NHS Ester

Sign In for Pricing
View Details
ZFAND2B Mouse Monoclonal Antibody [Clone ID: OTI1G9]
CF502363 100 µg

ZFAND2B Mouse Monoclonal Antibody [Clone ID: OTI1G9]

Sign In for Pricing
View Details
Lentiviral human MAP2 shRNA (UAS) - Lentiviral human MAP2 shRNA (UAS, iRFP) plasmid
GTR15309163 1 Vial

Lentiviral human MAP2 shRNA (UAS) - Lentiviral human MAP2 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Mouse Hu TCR Cbeta1 Purified, clone JOVI.1 (Monoclonal) Antibody
orb1882369 0.1 mg

Mouse Hu TCR Cbeta1 Purified, clone JOVI.1 (Monoclonal) Antibody

Sign In for Pricing
View Details
Mouse Monoclonal Ctip1 Antibody (BCL11A/123) [Alexa Fluor 750]
NBP2-50115AF750 0.1 mL

Mouse Monoclonal Ctip1 Antibody (BCL11A/123) [Alexa Fluor 750]

Sign In for Pricing
View Details