Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTNNA3 Rabbit Polyclonal Antibody (HRP)

CTNNA3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

VR22, ARVD13

UniProt

Q9UI47

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human CTNNA3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PLIIQVTTLVNCPQNPSSRKKGRSKRASVLLASVEEATWNLLDKGEKIAQ

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

56kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), Biotin conjugate, 0.1mg/mL
BNCB0679-500 1x 500 µL

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Vgl4 (VGLL4) (NM_001128219) Human Over-expression Lysate
LY426931 100 µg

Vgl4 (VGLL4) (NM_001128219) Human Over-expression Lysate

Sign In for Pricing
View Details
KChIP2 (KCNIP2) (NM_014591) Human Recombinant Protein
TP313131 20 µg

KChIP2 (KCNIP2) (NM_014591) Human Recombinant Protein

Sign In for Pricing
View Details
Slc39a13 Mouse Gene Knockout Kit (CRISPR)
KN516104 1 Kit

Slc39a13 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human ICEBERG (CARD18) activation kit by CRISPRa
GA111810 1 Kit

Human ICEBERG (CARD18) activation kit by CRISPRa

Sign In for Pricing
View Details
Shkbp1 Mouse Gene Knockout Kit (CRISPR)
KN515757 1 Kit

Shkbp1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details