Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EAF2 Rabbit Polyclonal Antibody (HRP)

EAF2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

U19, BM040, TRAITS

UniProt

Q96CJ1

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human EAF2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SSSSEDSSSDSEDEDCKSSTSDTGNCVSGHPTMTQYRIPDIDASHNRFRD

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

29kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_060926

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-CXCR5 Antibody Picoband®, Dylight550 Conjugate
PA2021-Dylight550 100 µg

Anti-CXCR5 Antibody Picoband®, Dylight550 Conjugate

Sign In for Pricing
View Details
RNF111 Rabbit Polyclonal Antibody (BF647)
orb2549092 100 µL

RNF111 Rabbit Polyclonal Antibody (BF647)

Sign In for Pricing
View Details
SAMSN1, ID (SAMSN1, HACS1, SAM domain-containing protein SAMSN-1, Hematopoietic adaptor containing SH3 and SAM domains 1, Nash1, SAM domain, SH3 domain and nuclear localization signals protein 1, SH3-SAM adaptor protein) (MaxLight 490) discontinued
041394-ML490 100 µL

SAMSN1, ID (SAMSN1, HACS1, SAM domain-containing protein SAMSN-1, Hematopoietic adaptor containing SH3 and SAM domains 1, Nash1, SAM domain, SH3 domain and nuclear localization signals protein 1, SH3-SAM adaptor protein) (MaxLight 490) discontinued

Sign In for Pricing
View Details
INSL3 ORF Vector (Human) (pORF)
ORF013371 1.0 µg DNA

INSL3 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
TTC33 (TTC33, Tetratricopeptide repeat protein 33, Osmosis-responsive factor) (PE)
MBS6359924-01 0.2 mL

TTC33 (TTC33, Tetratricopeptide repeat protein 33, Osmosis-responsive factor) (PE)

Sign In for Pricing
View Details
TTC33 (TTC33, Tetratricopeptide repeat protein 33, Osmosis-responsive factor) (PE)
MBS6359924-02 5x 0.2 mL

TTC33 (TTC33, Tetratricopeptide repeat protein 33, Osmosis-responsive factor) (PE)

Sign In for Pricing
View Details