Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BMP8A Rabbit Polyclonal Antibody (HRP)

BMP8A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

OP-2

UniProt

Q7Z5Y6

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human BMP8A

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FFRASPSPIRTPRAVRPLRRRQPKKSNELPQANRLPGIFDDVRGSHGRQV

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

44 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_861525

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human General Transcription Factor IIf, Polypeptide 1 ELISA Kit
MBS018422-01 48 Well

Human General Transcription Factor IIf, Polypeptide 1 ELISA Kit

Sign In for Pricing
View Details
Human General Transcription Factor IIf, Polypeptide 1 ELISA Kit
MBS018422-02 96 Well

Human General Transcription Factor IIf, Polypeptide 1 ELISA Kit

Sign In for Pricing
View Details
Human General Transcription Factor IIf, Polypeptide 1 ELISA Kit
MBS018422-03 5x 96 Well

Human General Transcription Factor IIf, Polypeptide 1 ELISA Kit

Sign In for Pricing
View Details
Human General Transcription Factor IIf, Polypeptide 1 ELISA Kit
MBS018422-04 10x 96 Well

Human General Transcription Factor IIf, Polypeptide 1 ELISA Kit

Sign In for Pricing
View Details
FRS2 Antibody (Center) Blocking Peptide
MBS9223795-01 0.5 mg

FRS2 Antibody (Center) Blocking Peptide

Sign In for Pricing
View Details
FRS2 Antibody (Center) Blocking Peptide
MBS9223795-02 5x 0.5 mg

FRS2 Antibody (Center) Blocking Peptide

Sign In for Pricing
View Details