Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SAMD3 Rabbit Polyclonal Antibody (FITC)

SAMD3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

FLJ34563, MGC35163

UniProt

Q8N6K7

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human SAMD3

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: ALVAAFHVFRIECPRRLSQTFNFLETLIFDMHSPYFPSLKEKENEVGFQH

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

57kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Human, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_001017373

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Interleukin-1 receptor type 1 ELISA Kit
MBS9425050-01 96 Tests

Mouse Interleukin-1 receptor type 1 ELISA Kit

Sign In for Pricing
View Details
Mouse Interleukin-1 receptor type 1 ELISA Kit
MBS9425050-02 5x 96 Tests

Mouse Interleukin-1 receptor type 1 ELISA Kit

Sign In for Pricing
View Details
AKT Monoclonal Antibody, PE-Cy5.5 Conjugated
bsm-33278M-PE-Cy5.5 100 µL

AKT Monoclonal Antibody, PE-Cy5.5 Conjugated

Sign In for Pricing
View Details
PIC M023-Dia 050-PE-SHEET/2 Safety & Regulatory Compliance Signs & Labels (Adhesive)
821249 2 Sheet (2 Panel (s) x 1 Sheet)

PIC M023-Dia 050-PE-SHEET/2 Safety & Regulatory Compliance Signs & Labels (Adhesive)

Sign In for Pricing
View Details
GPR34 (NM_001097579) Human Tagged Lenti ORF Clone
RC223795L3 10 µg

GPR34 (NM_001097579) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Human CD11a/LFA-1a Antibody : PE
OASB00918-100T 100 Tests

Human CD11a/LFA-1a Antibody : PE

Sign In for Pricing
View Details