Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STOX2 Rabbit Polyclonal Antibody (Biotin)

STOX2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

Q9P2F5

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human STOX2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: NKNTEEEKNREDVGTMQWLLEREKERDLQRKFEKNLTLLAPKETDSSSNQ

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

94kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VEGF-C Rabbit Polyclonal Antibody (PE-Cy7)
orb968897 100 µL

VEGF-C Rabbit Polyclonal Antibody (PE-Cy7)

Sign In for Pricing
View Details
Lentiviral mouse Preb shRNA (UAS) - Lentiviral mouse Preb shRNA (UAS, iRFP) plasmid
GTR15190576 1 Vial

Lentiviral mouse Preb shRNA (UAS) - Lentiviral mouse Preb shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
KIAA1529 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV812439 1.0 µg DNA

KIAA1529 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
CARD6, ID (Caspase recruitment domain-containing protein 6, CARD6) (PE)
MBS6280814-01 0.2 mL

CARD6, ID (Caspase recruitment domain-containing protein 6, CARD6) (PE)

Sign In for Pricing
View Details
CARD6, ID (Caspase recruitment domain-containing protein 6, CARD6) (PE)
MBS6280814-02 5x 0.2 mL

CARD6, ID (Caspase recruitment domain-containing protein 6, CARD6) (PE)

Sign In for Pricing
View Details
Pipette Filter tips, 100-1000 uL XL, Natural, Bulk, DNase/RNase free - 500 un. - ABDOS
P11015 500 Units/Pack

Pipette Filter tips, 100-1000 uL XL, Natural, Bulk, DNase/RNase free - 500 un. - ABDOS

Sign In for Pricing
View Details