Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MEDAG Rabbit Polyclonal Antibody (Biotin)

MEDAG Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

AWMS3, MEDA4, MEDA-4, hAWMS3, C13orf33

UniProt

Q5VYS4

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human MEDAG

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MLFFINVQTKKDTSKERTYAFLVNTRHPKIRRQIEQGMDMVISSVIGESY

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_116238

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IgG Antibody Phycoerythrin conjugated Pre-Adsorbed
orb347200 1 mL

Human IgG Antibody Phycoerythrin conjugated Pre-Adsorbed

Sign In for Pricing
View Details
RALY Protein Vector (Mouse) (pPM-C-HA)
PV222220 500 ng

RALY Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
IL27RA siRNA (Human)
CRH6282-01 15 nmol

IL27RA siRNA (Human)

Sign In for Pricing
View Details
IL27RA siRNA (Human)
CRH6282-02 30 nmol

IL27RA siRNA (Human)

Sign In for Pricing
View Details
HSPA1L (Heat Shock 70kD Protein 1-like, HSP70-Hom, Heat shock 70kD protein 1L, Heat Shock 70kD Protein 1-Hom) (Biotin)
128125-Biotin 100 µL

HSPA1L (Heat Shock 70kD Protein 1-like, HSP70-Hom, Heat shock 70kD protein 1L, Heat Shock 70kD Protein 1-Hom) (Biotin)

Sign In for Pricing
View Details
NKAIN2 3'UTR GFP Stable Cell Line
TU065705 1.0 mL

NKAIN2 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details