Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HE4/WFDC2, Human (HEK293, His)

The HE4/WFDC2 protein is a homotrimeric broad-spectrum protease inhibitor that regulates food intake, energy expenditure, and body weight in response to metabolic and toxin-induced stress. As a brainstem-restricted receptor, it binds to GDF15 and interacts with RET, activating MAPK and AKT signaling pathways. HE4/WFDC2 Protein, Human (HEK293, His) is the recombinant human-derived HE4/WFDC2 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

HE4/WFDC2 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/he4-wfdc2-protein-human-hek293-his.html

Purity

98.0

Smiles

EKTGVCPELQADQNCTQECVSDSECADNLKCCSAGCATFCSLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCVTPNF

Molecular Formula

10406 (Gene_ID) Q14508 (E31-F124) (Accession)

Molecular Weight

Approximately 18-24 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Adenosine A2b Receptor (ADORA2B) activation kit by CRISPRa
GA100095 1 Kit

Human Adenosine A2b Receptor (ADORA2B) activation kit by CRISPRa

Sign In for Pricing
View Details
Tretazicar (>94%)
TRC-T719800-500MG 500 mg

Tretazicar (>94%)

Sign In for Pricing
View Details
Recombinant Human Neuropilin-2/NRP2 Protein (His Tag)
PKSH030458 50 µg

Recombinant Human Neuropilin-2/NRP2 Protein (His Tag)

Sign In for Pricing
View Details
Tissue Total RNA, Esophagus
CR562715 5 µg

Tissue Total RNA, Esophagus

Sign In for Pricing
View Details
Clostebol
TRC-C587430-10MG 10 mg

Clostebol

Sign In for Pricing
View Details
Carbamylcholine Chloride
TRC-C175970-5G 5 g

Carbamylcholine Chloride

Sign In for Pricing
View Details