Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HE4/WFDC2, Human (HEK293, His)

The HE4/WFDC2 protein is a homotrimeric broad-spectrum protease inhibitor that regulates food intake, energy expenditure, and body weight in response to metabolic and toxin-induced stress. As a brainstem-restricted receptor, it binds to GDF15 and interacts with RET, activating MAPK and AKT signaling pathways. HE4/WFDC2 Protein, Human (HEK293, His) is the recombinant human-derived HE4/WFDC2 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

HE4/WFDC2 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/he4-wfdc2-protein-human-hek293-his.html

Purity

98.0

Smiles

EKTGVCPELQADQNCTQECVSDSECADNLKCCSAGCATFCSLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCVTPNF

Molecular Formula

10406 (Gene_ID) Q14508 (E31-F124) (Accession)

Molecular Weight

Approximately 18-24 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Josephin 1 (JOSD1) Rabbit Polyclonal Antibody
TA370761 100 µL

Josephin 1 (JOSD1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human Sarcosine Oxidase (PIPOX) activation kit by CRISPRa
GA109691 1 Kit

Human Sarcosine Oxidase (PIPOX) activation kit by CRISPRa

Sign In for Pricing
View Details
Gastrin (GAST/2632), CF647 conjugate, 0.1mg/mL
BNC472632-500 1x 500 µL

Gastrin (GAST/2632), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
o-Nitrophenylsulfonyl Chloride
TRC-N505050-25G 25 g

o-Nitrophenylsulfonyl Chloride

Sign In for Pricing
View Details
GAR1 Polyclonal Antibody
E-AB-90469-01 60 µL

GAR1 Polyclonal Antibody

Sign In for Pricing
View Details
GAR1 Polyclonal Antibody
E-AB-90469-02 120 µL

GAR1 Polyclonal Antibody

Sign In for Pricing
View Details