Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HE4/WFDC2, Human (HEK293, His)

The HE4/WFDC2 protein is a homotrimeric broad-spectrum protease inhibitor that regulates food intake, energy expenditure, and body weight in response to metabolic and toxin-induced stress. As a brainstem-restricted receptor, it binds to GDF15 and interacts with RET, activating MAPK and AKT signaling pathways. HE4/WFDC2 Protein, Human (HEK293, His) is the recombinant human-derived HE4/WFDC2 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

HE4/WFDC2 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/he4-wfdc2-protein-human-hek293-his.html

Purity

98.0

Smiles

EKTGVCPELQADQNCTQECVSDSECADNLKCCSAGCATFCSLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCVTPNF

Molecular Formula

10406 (Gene_ID) Q14508 (E31-F124) (Accession)

Molecular Weight

Approximately 18-24 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant FXR1 Antibody
RC-16236-01 50 μL

Recombinant FXR1 Antibody

Sign In for Pricing
View Details
Recombinant FXR1 Antibody
RC-16236-02 100 µL

Recombinant FXR1 Antibody

Sign In for Pricing
View Details
Recombinant FXR1 Antibody
RC-16236-03 1 mL

Recombinant FXR1 Antibody

Sign In for Pricing
View Details
Repetin (RPTN) Human Gene Knockout Kit (CRISPR)
KN426166 1 Kit

Repetin (RPTN) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Chk2 (CHEK2) Human Gene Knockout Kit (CRISPR)
KN201278 1 Kit

Chk2 (CHEK2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TRIM29 Human Gene Knockout Kit (CRISPR)
KN201916BN 1 Kit

TRIM29 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details