Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HE4/WFDC2, Human (HEK293, His)

The HE4/WFDC2 protein is a homotrimeric broad-spectrum protease inhibitor that regulates food intake, energy expenditure, and body weight in response to metabolic and toxin-induced stress. As a brainstem-restricted receptor, it binds to GDF15 and interacts with RET, activating MAPK and AKT signaling pathways. HE4/WFDC2 Protein, Human (HEK293, His) is the recombinant human-derived HE4/WFDC2 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

HE4/WFDC2 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/he4-wfdc2-protein-human-hek293-his.html

Purity

98.0

Smiles

EKTGVCPELQADQNCTQECVSDSECADNLKCCSAGCATFCSLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCVTPNF

Molecular Formula

10406 (Gene_ID) Q14508 (E31-F124) (Accession)

Molecular Weight

Approximately 18-24 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-Chloro-D-phenylalanine methyl ester hydrochloride
269709-01 1 g

4-Chloro-D-phenylalanine methyl ester hydrochloride

Sign In for Pricing
View Details
4-Chloro-D-phenylalanine methyl ester hydrochloride
269709-02 2 g

4-Chloro-D-phenylalanine methyl ester hydrochloride

Sign In for Pricing
View Details
4-Chloro-D-phenylalanine methyl ester hydrochloride
269709-03 5 g

4-Chloro-D-phenylalanine methyl ester hydrochloride

Sign In for Pricing
View Details
4-Chloro-D-phenylalanine methyl ester hydrochloride
269709-04 10 g

4-Chloro-D-phenylalanine methyl ester hydrochloride

Sign In for Pricing
View Details
4-Chloro-D-phenylalanine methyl ester hydrochloride
269709-05 25 g

4-Chloro-D-phenylalanine methyl ester hydrochloride

Sign In for Pricing
View Details
Protein SEC13 homolog (SEC13) Mouse ELISA Kit
G4127 96 Tests

Protein SEC13 homolog (SEC13) Mouse ELISA Kit

Sign In for Pricing
View Details