Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

INKA1 Rabbit Polyclonal Antibody (FITC)

INKA1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

C3orf54, FAM212A

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human FAM212A

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: RAPVASVPPVHHPRPKSTPDACLEHWQGLEAEDWTAALLNRGRSRQPLVL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

31kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_976248

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LMAN1 Recombinant Rabbit Monoclonal Antibody [JE55-19]
ET7110-98 100 µL

LMAN1 Recombinant Rabbit Monoclonal Antibody [JE55-19]

Sign In for Pricing
View Details
PNR (TAAR5) (NM_003967) Human Over-expression Lysate
LC401302 20 µg

PNR (TAAR5) (NM_003967) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon: right
CS644288 5x 5 µm

Frozen Tissue Sections, Colon: right

Sign In for Pricing
View Details
Bcl-x (2H12), CF488A conjugate, 0.1mg/mL
BNC880751-100 1x 100 µL

Bcl-x (2H12), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human PSGL-1/CD162 Protein (His & Fc Tag)
PKSH031570 100 µg

Recombinant Human PSGL-1/CD162 Protein (His & Fc Tag)

Sign In for Pricing
View Details
Car6 Mouse Gene Knockout Kit (CRISPR)
KN502537 1 Kit

Car6 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details