Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

INKA2 Rabbit Polyclonal Antibody (FITC)

INKA2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

FAM212B, C1orf183

UniProt

Q9NTI7

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human FAM212B

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: WTSTLMSRGRNRQPLVLGDNVFADLVGNWLDLPELEKGGEKGETGGAREP

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

32kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human NIFK shRNA (UAS) - Lentiviral human NIFK shRNA (UAS) (100)
GTR15328713 1 Vial

Lentiviral human NIFK shRNA (UAS) - Lentiviral human NIFK shRNA (UAS) (100)

Sign In for Pricing
View Details
Monkey Growth Factor Receptor Bound Protein 7 ELISA Kit
MBS029719-01 48 Well

Monkey Growth Factor Receptor Bound Protein 7 ELISA Kit

Sign In for Pricing
View Details
Monkey Growth Factor Receptor Bound Protein 7 ELISA Kit
MBS029719-02 96 Well

Monkey Growth Factor Receptor Bound Protein 7 ELISA Kit

Sign In for Pricing
View Details
Monkey Growth Factor Receptor Bound Protein 7 ELISA Kit
MBS029719-03 5x 96 Well

Monkey Growth Factor Receptor Bound Protein 7 ELISA Kit

Sign In for Pricing
View Details
Monkey Growth Factor Receptor Bound Protein 7 ELISA Kit
MBS029719-04 10x 96 Well

Monkey Growth Factor Receptor Bound Protein 7 ELISA Kit

Sign In for Pricing
View Details
IspD Antibody
orb819681 2 mg

IspD Antibody

Sign In for Pricing
View Details