Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NUGGC Rabbit Polyclonal Antibody (HRP)

NUGGC Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SLIPGC, C8orf80, SLIP-GC, HMFN0672

UniProt

Q68CJ6

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human NUGGC

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RSGWKYDSCKKNFLIQEISAILGGLEDHILRRKRRIYESLTASVQSDLKL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

91kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Porcine, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_001010906

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

B-cell CLL/Lymphoma 10 Human Recombinant (BCL10 Human)
PT_P10144-01 1 µg

B-cell CLL/Lymphoma 10 Human Recombinant (BCL10 Human)

Sign In for Pricing
View Details
B-cell CLL/Lymphoma 10 Human Recombinant (BCL10 Human)
PT_P10144-02 5 µg

B-cell CLL/Lymphoma 10 Human Recombinant (BCL10 Human)

Sign In for Pricing
View Details
B-cell CLL/Lymphoma 10 Human Recombinant (BCL10 Human)
PT_P10144-03 50 µg

B-cell CLL/Lymphoma 10 Human Recombinant (BCL10 Human)

Sign In for Pricing
View Details
LEFTY1 Rabbit Polyclonal Antibody
orb325735 100 µL

LEFTY1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Lentiviral human MICAL3 sgRNA gene knockout kit - Lentiviral human MICAL3 sgRNA gene knockout kit (plasmid)
GTR15374189 1 Vial

Lentiviral human MICAL3 sgRNA gene knockout kit - Lentiviral human MICAL3 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
Human IL-17E/IL-25 (Interleukin 25) QuickTest ELISA Kit
MBS7618721-01 48 Well

Human IL-17E/IL-25 (Interleukin 25) QuickTest ELISA Kit

Sign In for Pricing
View Details