Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR51B6 Rabbit Polyclonal Antibody (HRP)

OR51B6 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HOR5'Beta6

UniProt

Q9H340

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR51B6

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VLFAMVLLDFLIIFFSYILILKTVMGIGSGGERAKALNTCVSHICCILVF

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001004750

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KRT75, NT (KRT75, K6HF, KB18, Keratin, type II cytoskeletal 75, Cytokeratin-75, Keratin-6 hair follicle, Keratin-75, Type II keratin-K6hf, Type-II keratin Kb18) (MaxLight 405)
MBS6314782-01 0.1 mL

KRT75, NT (KRT75, K6HF, KB18, Keratin, type II cytoskeletal 75, Cytokeratin-75, Keratin-6 hair follicle, Keratin-75, Type II keratin-K6hf, Type-II keratin Kb18) (MaxLight 405)

Sign In for Pricing
View Details
KRT75, NT (KRT75, K6HF, KB18, Keratin, type II cytoskeletal 75, Cytokeratin-75, Keratin-6 hair follicle, Keratin-75, Type II keratin-K6hf, Type-II keratin Kb18) (MaxLight 405)
MBS6314782-02 5x 0.1 mL

KRT75, NT (KRT75, K6HF, KB18, Keratin, type II cytoskeletal 75, Cytokeratin-75, Keratin-6 hair follicle, Keratin-75, Type II keratin-K6hf, Type-II keratin Kb18) (MaxLight 405)

Sign In for Pricing
View Details
IZUM1, NT (IZUMO1, Izumo sperm-egg fusion protein 1, Oocyte binding/fusion factor, Sperm-specific protein izumo) (MaxLight 650) discontinued
037171-ML650 100 µL

IZUM1, NT (IZUMO1, Izumo sperm-egg fusion protein 1, Oocyte binding/fusion factor, Sperm-specific protein izumo) (MaxLight 650) discontinued

Sign In for Pricing
View Details
GOLGB1 Antibody
orb686236-01 50 μL

GOLGB1 Antibody

Sign In for Pricing
View Details
GOLGB1 Antibody
orb686236-02 100 µL

GOLGB1 Antibody

Sign In for Pricing
View Details
Recombinant Mouse Bridging integrator 3 (Bin3)
MBS1367554-01 0.02 mg (E-Coli)

Recombinant Mouse Bridging integrator 3 (Bin3)

Sign In for Pricing
View Details