Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANKRD34C Rabbit Polyclonal Antibody (Biotin)

ANKRD34C Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

H3BNM1

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human ANKRD34C

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SNDKGETALMVACITKHVDQQSISKSKMVKYLLDNRADPNIQDKSGKTAL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

58kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001139813

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human LAIR2 sgRNA gene knockout kit - Lentiviral human LAIR2 sgRNA gene knockout kit (25)
GTR15381198 1 Vial

Lentiviral human LAIR2 sgRNA gene knockout kit - Lentiviral human LAIR2 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
Mouse Monoclonal Pancreatic trypsin inhibitor Antibody (21) [Alexa Fluor 405]
NBP2-23589AF405 0.1 mL

Mouse Monoclonal Pancreatic trypsin inhibitor Antibody (21) [Alexa Fluor 405]

Sign In for Pricing
View Details
4921517D22Rik Double Nickase Plasmid (m)
sc-427836-NIC 20 µg

4921517D22Rik Double Nickase Plasmid (m)

Sign In for Pricing
View Details
Lentiviral mouse Nradd shRNA (UAS) - Lentiviral mouse Nradd shRNA (UAS, iRFP) (25)
GTR15167678 1 Vial

Lentiviral mouse Nradd shRNA (UAS) - Lentiviral mouse Nradd shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
ITGB3 Protein Vector (Human) (pPM-C-His)
PV053564 500 ng

ITGB3 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
MIRO1 (RHOT1) (NM_001033568) Human Over-expression Lysate
LS055288 100 µg

MIRO1 (RHOT1) (NM_001033568) Human Over-expression Lysate

Sign In for Pricing
View Details