Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANKRD34C Rabbit Polyclonal Antibody (HRP)

ANKRD34C Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

H3BNM1

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human ANKRD34C

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SNDKGETALMVACITKHVDQQSISKSKMVKYLLDNRADPNIQDKSGKTAL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

58kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001139813

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Basic hair keratin K81 antibody
20R-2623 100 µL

Basic hair keratin K81 antibody

Sign In for Pricing
View Details
Human Complement Component 1, Q Subcomponent Like Protein 1 (C1qL1) ELISA Kit
orb2667761-01 48 Tests

Human Complement Component 1, Q Subcomponent Like Protein 1 (C1qL1) ELISA Kit

Sign In for Pricing
View Details
Human Complement Component 1, Q Subcomponent Like Protein 1 (C1qL1) ELISA Kit
orb2667761-02 96 Tests

Human Complement Component 1, Q Subcomponent Like Protein 1 (C1qL1) ELISA Kit

Sign In for Pricing
View Details
NKG2A/CIE (Natural Killer, NK) discontinued
N2851-75H 100 µg

NKG2A/CIE (Natural Killer, NK) discontinued

Sign In for Pricing
View Details
IMPACT Rabbit Polyclonal Antibody (PE-Cy5)
orb927077 100 µL

IMPACT Rabbit Polyclonal Antibody (PE-Cy5)

Sign In for Pricing
View Details
Complete Medium for BS-C-1 Cells
abx703140 500 mL

Complete Medium for BS-C-1 Cells

Sign In for Pricing
View Details