Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARL13A Rabbit Polyclonal Antibody (Biotin)

ARL13A Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

ARL13, dJ341D10.2

UniProt

Q5H913

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human ARL13A

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: TCQLPPTSSISISKNNTGSGERCSSHSFSTRTGMSKEKRQHLEQCSIEAK

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

31kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Porcine, Rabbit

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Synechococcus elongatus (strain PCC 7942)(Anacystis nidulans R2) glyQ Polyclonal Antibody
MBS7193578 Inquire

Rabbit anti-Synechococcus elongatus (strain PCC 7942)(Anacystis nidulans R2) glyQ Polyclonal Antibody

Sign In for Pricing
View Details
TIF1 alpha antibody
70R-50643 100 µL

TIF1 alpha antibody

Sign In for Pricing
View Details
CD274 Peptide - C-terminal region
orb2008099 100 µg

CD274 Peptide - C-terminal region

Sign In for Pricing
View Details
HOXD13 Antibody, FITC conjugated
CSB-PA010685LC01HU-01 50 µg

HOXD13 Antibody, FITC conjugated

Sign In for Pricing
View Details
HOXD13 Antibody, FITC conjugated
CSB-PA010685LC01HU-02 100 µg

HOXD13 Antibody, FITC conjugated

Sign In for Pricing
View Details
Baculoviral IAP Repeat-Containing Protein 5 (BIRC5) Antibody Pair
abx370571-01 5x 96 Tests

Baculoviral IAP Repeat-Containing Protein 5 (BIRC5) Antibody Pair

Sign In for Pricing
View Details