Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARL13A Rabbit Polyclonal Antibody (FITC)

ARL13A Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

ARL13, dJ341D10.2

UniProt

Q5H913

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human ARL13A

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: TCQLPPTSSISISKNNTGSGERCSSHSFSTRTGMSKEKRQHLEQCSIEAK

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

31kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Porcine, Rabbit

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRKRA Polyclonal Antibody
E55A02690 100 µg

PRKRA Polyclonal Antibody

Sign In for Pricing
View Details
UBAC1, CT (UBAC1, GBDR1, KPC2, UBADC1, Ubiquitin-associated domain-containing protein 1, E3 ubiquitin-protein ligase subunit KPC2, Glialblastoma cell differentiation-related protein 1, Kip1 ubiquitination-promoting complex protein 2) (MaxLight 550)
MBS6360570-01 0.1 mL

UBAC1, CT (UBAC1, GBDR1, KPC2, UBADC1, Ubiquitin-associated domain-containing protein 1, E3 ubiquitin-protein ligase subunit KPC2, Glialblastoma cell differentiation-related protein 1, Kip1 ubiquitination-promoting complex protein 2) (MaxLight 550)

Sign In for Pricing
View Details
UBAC1, CT (UBAC1, GBDR1, KPC2, UBADC1, Ubiquitin-associated domain-containing protein 1, E3 ubiquitin-protein ligase subunit KPC2, Glialblastoma cell differentiation-related protein 1, Kip1 ubiquitination-promoting complex protein 2) (MaxLight 550)
MBS6360570-02 5x 0.1 mL

UBAC1, CT (UBAC1, GBDR1, KPC2, UBADC1, Ubiquitin-associated domain-containing protein 1, E3 ubiquitin-protein ligase subunit KPC2, Glialblastoma cell differentiation-related protein 1, Kip1 ubiquitination-promoting complex protein 2) (MaxLight 550)

Sign In for Pricing
View Details
Rat Monoclonal Angiopoietin-like Protein 2/ANGPTL2 Antibody (RM0152-6F16) [FITC]
NBP2-12040F 0.1 mL

Rat Monoclonal Angiopoietin-like Protein 2/ANGPTL2 Antibody (RM0152-6F16) [FITC]

Sign In for Pricing
View Details
Human MRC2 HEK293 Cell Line
E24C00471 1 Vial

Human MRC2 HEK293 Cell Line

Sign In for Pricing
View Details
Pxt1 Mouse shRNA Lentiviral Particle (Locus ID 69307)
TL519697V 500 µL Each

Pxt1 Mouse shRNA Lentiviral Particle (Locus ID 69307)

Sign In for Pricing
View Details