Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARL13A Rabbit Polyclonal Antibody (FITC)

ARL13A Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

ARL13, dJ341D10.2

UniProt

Q5H913

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human ARL13A

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LTHLLSDKRVAGKPILILANKQDKKKALMPCDIIDYLLLKKLVKENKCPC

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

32kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001013008

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCDHGC3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV792306 1.0 µg DNA

PCDHGC3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Apolipoprotein A1 Binding Protein (APOA1BP)
MBS2072678-01 0.1 mL

FITC-Linked Polyclonal Antibody to Apolipoprotein A1 Binding Protein (APOA1BP)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Apolipoprotein A1 Binding Protein (APOA1BP)
MBS2072678-02 0.2 mL

FITC-Linked Polyclonal Antibody to Apolipoprotein A1 Binding Protein (APOA1BP)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Apolipoprotein A1 Binding Protein (APOA1BP)
MBS2072678-03 0.5 mL

FITC-Linked Polyclonal Antibody to Apolipoprotein A1 Binding Protein (APOA1BP)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Apolipoprotein A1 Binding Protein (APOA1BP)
MBS2072678-04 1 mL

FITC-Linked Polyclonal Antibody to Apolipoprotein A1 Binding Protein (APOA1BP)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Apolipoprotein A1 Binding Protein (APOA1BP)
MBS2072678-05 5 mL

FITC-Linked Polyclonal Antibody to Apolipoprotein A1 Binding Protein (APOA1BP)

Sign In for Pricing
View Details