Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C1orf141 Rabbit Polyclonal Antibody (FITC)

C1orf141 Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

Q5JVX7

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human C1orf141

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: KAISKIKEDKSCSITKSKMHVSFKCEPEPRKSNFEKSNLRPFFIQTNVKN

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

44kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Guinea pig, Human, Porcine

Tested Applications

WB

NCBI Accession Number

NP_001263280

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD87/PLAUR/uPAR Protein (C-His, Mus musculus (Mouse) )
P502301 100 µg

CD87/PLAUR/uPAR Protein (C-His, Mus musculus (Mouse) )

Sign In for Pricing
View Details
Recombinant Xenopus laevis ATP synthase subunit a (mt-atp6)
orb2912196-01 20 µg

Recombinant Xenopus laevis ATP synthase subunit a (mt-atp6)

Sign In for Pricing
View Details
Recombinant Xenopus laevis ATP synthase subunit a (mt-atp6)
orb2912196-02 100 µg

Recombinant Xenopus laevis ATP synthase subunit a (mt-atp6)

Sign In for Pricing
View Details
Rabbit anti-Ashbya gossypii (strain 10895/CBS 109.51/FGSC 9923/NRRL Y-1056)(Yeast)(Eremothecium gossypii) PFA4 Polyclonal Antibody
MBS7198423 Inquire

Rabbit anti-Ashbya gossypii (strain 10895/CBS 109.51/FGSC 9923/NRRL Y-1056)(Yeast)(Eremothecium gossypii) PFA4 Polyclonal Antibody

Sign In for Pricing
View Details
Human AGTR-1 Alexa Fluor 594 MAb (1010103)
FAB10244T-100UG 100 µg

Human AGTR-1 Alexa Fluor 594 MAb (1010103)

Sign In for Pricing
View Details
KIT, phosphorylated (Y730) (KIT, SCFR, Mast/stem cell growth factor receptor Kit, Piebald trait protein, Proto-oncogene c-Kit, Tyrosine-protein kinase Kit, p145 c-kit, v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog, CD117) (MaxLight 550) discontinued
037510-ML550 100 µL

KIT, phosphorylated (Y730) (KIT, SCFR, Mast/stem cell growth factor receptor Kit, Piebald trait protein, Proto-oncogene c-Kit, Tyrosine-protein kinase Kit, p145 c-kit, v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog, CD117) (MaxLight 550) discontinued

Sign In for Pricing
View Details