Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C4orf47 Rabbit Polyclonal Antibody (HRP)

C4orf47 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

A7E2U8

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human C4orf47

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FDANPYFSEESLPPIKKEEKKKTISNTFKPSSPGKKPGGMKAGTFDPYPS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001107829

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAP2 (NM_002374) Human Over-expression Lysate
LY419369 100 µg

MAP2 (NM_002374) Human Over-expression Lysate

Sign In for Pricing
View Details
CCDC134 Rabbit Polyclonal Antibody
TA366432 100 µL

CCDC134 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD21 (Mature B-Cell & Follicular Dendritic Cell Marker) (CR2/3247), CF568 conjugate, 0.1mg/mL
BNC683247-100 1x 100 µL

CD21 (Mature B-Cell & Follicular Dendritic Cell Marker) (CR2/3247), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Hoechst 33258 *20 mM solution in water*
17525-AAT 5 mL

Hoechst 33258 *20 mM solution in water*

Sign In for Pricing
View Details
Cyclin E (G1/S-Phase Cyclin) (CCNE1/2460), CF488A conjugate, 0.1mg/mL
BNC882460-100 1x 100 µL

Cyclin E (G1/S-Phase Cyclin) (CCNE1/2460), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MC4 Receptor (MC4R) Rabbit Polyclonal Antibody
TA378380 100 µL

MC4 Receptor (MC4R) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details