Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR10J3 Rabbit Polyclonal Antibody (FITC)

OR10J3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

OR1-25, OR10J3P

UniProt

Q5JRS4

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR10J3

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: HLTVVIIHYGCASIIYLKPKSQSSLGQDRLISVTYTHHSPTEPCCVQPEE

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001004467

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sirius Red (Collagen Fiber) Control Slides, Paraffin Sections
CS-SIRD 5 Slides/Pack

Sirius Red (Collagen Fiber) Control Slides, Paraffin Sections

Sign In for Pricing
View Details
LOC686719 3'UTR GFP Stable Cell Line
TU261468 1.0 mL

LOC686719 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
RPL39P21 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV781281 1.0 µg DNA

RPL39P21 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
CCL15 (C-C Motif Chemokine 15, Chemokine CC-2, HCC-2, Leukotactin-1, LKN-1, MIP-1 delta, Macrophage Inflammatory Protein 5, MIP-5, Mrp-2b, NCC-3, Small-inducible Cytokine A15, MIP5, NCC3, SCYA15) (HRP)
MBS6372535-01 0.1 mL

CCL15 (C-C Motif Chemokine 15, Chemokine CC-2, HCC-2, Leukotactin-1, LKN-1, MIP-1 delta, Macrophage Inflammatory Protein 5, MIP-5, Mrp-2b, NCC-3, Small-inducible Cytokine A15, MIP5, NCC3, SCYA15) (HRP)

Sign In for Pricing
View Details
CCL15 (C-C Motif Chemokine 15, Chemokine CC-2, HCC-2, Leukotactin-1, LKN-1, MIP-1 delta, Macrophage Inflammatory Protein 5, MIP-5, Mrp-2b, NCC-3, Small-inducible Cytokine A15, MIP5, NCC3, SCYA15) (HRP)
MBS6372535-02 5x 0.1 mL

CCL15 (C-C Motif Chemokine 15, Chemokine CC-2, HCC-2, Leukotactin-1, LKN-1, MIP-1 delta, Macrophage Inflammatory Protein 5, MIP-5, Mrp-2b, NCC-3, Small-inducible Cytokine A15, MIP5, NCC3, SCYA15) (HRP)

Sign In for Pricing
View Details
PE/Cyanine5.5 Anti-Mouse CD161/NK1.1 Antibody
MBS4515802-01 0.025 mg

PE/Cyanine5.5 Anti-Mouse CD161/NK1.1 Antibody

Sign In for Pricing
View Details