Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR10J3 Rabbit Polyclonal Antibody (HRP)

OR10J3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

OR1-25, OR10J3P

UniProt

Q5JRS4

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR10J3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: HLTVVIIHYGCASIIYLKPKSQSSLGQDRLISVTYTHHSPTEPCCVQPEE

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001004467

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Saccharomyces cerevisiae Uncharacterized protein YDL176W (YDL176W) , partial
MBS1453694 Inquire

Recombinant Saccharomyces cerevisiae Uncharacterized protein YDL176W (YDL176W) , partial

Sign In for Pricing
View Details
AQ-RA 741
TRC-A735440-500MG 500 mg

AQ-RA 741

Sign In for Pricing
View Details
NELL2 Antibody, HRP conjugated
CSB-PA859098LB01HU-01 50 µg

NELL2 Antibody, HRP conjugated

Sign In for Pricing
View Details
NELL2 Antibody, HRP conjugated
CSB-PA859098LB01HU-02 100 µg

NELL2 Antibody, HRP conjugated

Sign In for Pricing
View Details
Glutathione S Transferase mu 1 Rabbit Monoclonal Antibody
E10G21455 100 µL

Glutathione S Transferase mu 1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Anti-CEP70 antibody
STJ92229 200 µl

Anti-CEP70 antibody

Sign In for Pricing
View Details