Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C16orf90 Rabbit Polyclonal Antibody (HRP)

C16orf90 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

A8MZG2

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human C16orf90

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: APPNIYEGGLGSPQPQCPSAQGSKPKNFRLRHLRGLGLYLESHPPPTGQC

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

19kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001073993

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CLINT1 Mouse Monoclonal Antibody [Clone:9E1]
E45M17146 100 µg

CLINT1 Mouse Monoclonal Antibody [Clone:9E1]

Sign In for Pricing
View Details
P-Hydroxy Diphenyl For Synthesis
108440 100 100 g

P-Hydroxy Diphenyl For Synthesis

Sign In for Pricing
View Details
RPMI 1640 Medium Modified w/o L-Glutamine, w/o Amino acids, Glucose, Choline Chloride (Powder)
R9010-03-01 10 L

RPMI 1640 Medium Modified w/o L-Glutamine, w/o Amino acids, Glucose, Choline Chloride (Powder)

Sign In for Pricing
View Details
RPMI 1640 Medium Modified w/o L-Glutamine, w/o Amino acids, Glucose, Choline Chloride (Powder)
R9010-03-02 25 L

RPMI 1640 Medium Modified w/o L-Glutamine, w/o Amino acids, Glucose, Choline Chloride (Powder)

Sign In for Pricing
View Details
RPMI 1640 Medium Modified w/o L-Glutamine, w/o Amino acids, Glucose, Choline Chloride (Powder)
R9010-03-03 50 L

RPMI 1640 Medium Modified w/o L-Glutamine, w/o Amino acids, Glucose, Choline Chloride (Powder)

Sign In for Pricing
View Details
RPMI 1640 Medium Modified w/o L-Glutamine, w/o Amino acids, Glucose, Choline Chloride (Powder)
R9010-03-04 100 L

RPMI 1640 Medium Modified w/o L-Glutamine, w/o Amino acids, Glucose, Choline Chloride (Powder)

Sign In for Pricing
View Details