Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C19orf67 Rabbit Polyclonal Antibody (Biotin)

C19orf67 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

A6NJJ6

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human C19orf67

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: GPAPPRLSLDTLFSPITQQLRYLLKKADDFQSYLLYSRDQVQKEQLAKAM

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

XP_003403752

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DNAJC12 CRISPR Knock Out 293T Cell Line (Human)
18393141 1x 10^6 Cells / 1.0 mL

DNAJC12 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
Caseine Kinase 1 alpha Recombinant Antibody, AbBy Fluor™ 594 Conjugated
bsm-62225R-BF594 100 µL

Caseine Kinase 1 alpha Recombinant Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
Human Hantavirus (HV) IgM ELISA Kit
E-HD-E020-01 96 Tests

Human Hantavirus (HV) IgM ELISA Kit

Sign In for Pricing
View Details
Human Hantavirus (HV) IgM ELISA Kit
E-HD-E020-02 2x 96 Tests

Human Hantavirus (HV) IgM ELISA Kit

Sign In for Pricing
View Details
Slc13a1 ORF Vector (Rat) (pORF)
ORF076308 1.0 µg DNA

Slc13a1 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Radical Fringe Polyclonal Antibody, AbBy Fluor™ 647 Conjugated
bs-11948R-BF647 100 µL

Radical Fringe Polyclonal Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details