Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTPN20A Rabbit Polyclonal Antibody (FITC)

PTPN20A Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

CT126, PTPN20B, hPTPN20, bA142I17.1

UniProt

Q4JDL3

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human PTPN20A

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LEEKTAAYDIMQEFMALELKNLPGEFNSGNQPSNREKNRYRDILPYDSTR

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Porcine, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nori® Mouse BMP4 ELISA Kit
GR117139 96 Well

Nori® Mouse BMP4 ELISA Kit

Sign In for Pricing
View Details
Recombinant Escherichia coli O81 Exodeoxyribonuclease 7 small subunit (xseB)
MBS1025078-01 0.02 mg (E-Coli)

Recombinant Escherichia coli O81 Exodeoxyribonuclease 7 small subunit (xseB)

Sign In for Pricing
View Details
Recombinant Escherichia coli O81 Exodeoxyribonuclease 7 small subunit (xseB)
MBS1025078-02 0.1 mg (E-Coli)

Recombinant Escherichia coli O81 Exodeoxyribonuclease 7 small subunit (xseB)

Sign In for Pricing
View Details
Recombinant Escherichia coli O81 Exodeoxyribonuclease 7 small subunit (xseB)
MBS1025078-03 0.02 mg (Yeast)

Recombinant Escherichia coli O81 Exodeoxyribonuclease 7 small subunit (xseB)

Sign In for Pricing
View Details
Recombinant Escherichia coli O81 Exodeoxyribonuclease 7 small subunit (xseB)
MBS1025078-04 0.1 mg (Yeast)

Recombinant Escherichia coli O81 Exodeoxyribonuclease 7 small subunit (xseB)

Sign In for Pricing
View Details
Recombinant Escherichia coli O81 Exodeoxyribonuclease 7 small subunit (xseB)
MBS1025078-05 0.02 mg (Baculovirus)

Recombinant Escherichia coli O81 Exodeoxyribonuclease 7 small subunit (xseB)

Sign In for Pricing
View Details