Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

XAGE1A Rabbit Polyclonal Antibody (FITC)

XAGE1A Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

CTP9, XAGE1, CT12.1, GAGED2, XAGE-1, XAGE1B, CT12.1A, CT12.1B

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human XAGE1B

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: HERHTQTQNHTASPRSPVMESPKKKNQQLKVGILHLGSRQKKIRIQLRSQ

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

17kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_001091064

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CELF3 Human Pre-designed siRNA Set A
HY-RS02461 1 Set

CELF3 Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
TMX1 Polyclonal Antibody
E-AB-91734-01 60 µL

TMX1 Polyclonal Antibody

Sign In for Pricing
View Details
TMX1 Polyclonal Antibody
E-AB-91734-02 120 µL

TMX1 Polyclonal Antibody

Sign In for Pricing
View Details
TMX1 Polyclonal Antibody
E-AB-91734-03 200 µL

TMX1 Polyclonal Antibody

Sign In for Pricing
View Details
Caveolin 1 (CAV1) (NM_001172895) Human Untagged Clone
SC328227 10 µg

Caveolin 1 (CAV1) (NM_001172895) Human Untagged Clone

Sign In for Pricing
View Details
Human hepatitis C virus, HCV antibody, IgM ELISA Kit
MBS1610735 96 Well

Human hepatitis C virus, HCV antibody, IgM ELISA Kit

Sign In for Pricing
View Details