Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

XAGE1A Rabbit Polyclonal Antibody (HRP)

XAGE1A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CTP9, XAGE1, CT12.1, GAGED2, XAGE-1, XAGE1B, CT12.1A, CT12.1B

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human XAGE1B

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: HERHTQTQNHTASPRSPVMESPKKKNQQLKVGILHLGSRQKKIRIQLRSQ

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

17kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_001091064

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C1QTNF6 Protein Vector (Human) (pPB-His-MBP)
PV330254 500 ng

C1QTNF6 Protein Vector (Human) (pPB-His-MBP)

Sign In for Pricing
View Details
RPS6KA1 (RPS6KA1, MAPKAPK1A, RSK1, Ribosomal protein S6 kinase alpha-1, 90kD ribosomal protein S6 kinase 1, MAP kinase-activated protein kinase 1a, Ribosomal S6 kinase 1) (MaxLight 750) discontinued
031222-ML750 100 µL

RPS6KA1 (RPS6KA1, MAPKAPK1A, RSK1, Ribosomal protein S6 kinase alpha-1, 90kD ribosomal protein S6 kinase 1, MAP kinase-activated protein kinase 1a, Ribosomal S6 kinase 1) (MaxLight 750) discontinued

Sign In for Pricing
View Details
TINAGL1 Antibody
MBS9630724-01 0.1 mL

TINAGL1 Antibody

Sign In for Pricing
View Details
TINAGL1 Antibody
MBS9630724-02 0.2 mL

TINAGL1 Antibody

Sign In for Pricing
View Details
TINAGL1 Antibody
MBS9630724-03 5x 0.2 mL

TINAGL1 Antibody

Sign In for Pricing
View Details
FAS Antibody
orb423438-01 0.5 mg

FAS Antibody

Sign In for Pricing
View Details