Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AFDN-DT Rabbit Polyclonal Antibody (FITC)

AFDN-DT Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

HGC6.4, AFDN-AS1, C6orf124, MLLT4-AS1, dJ431P23.3

UniProt

Q9Y6Z5

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human MLLT4-AS1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: WTGGAGSKWGCSAGSGRAVLGPNGRWVPWAVLGSVRTGGAGSKWAALGPM

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_001035973

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

FBXL3 (F-Box and Leucine-Rich Repeat Protein 3, FBL3, FBL3A, FBXL3A) (FITC)
246008-FITC 100 µL

FBXL3 (F-Box and Leucine-Rich Repeat Protein 3, FBL3, FBL3A, FBXL3A) (FITC)

Sign In for Pricing
View Details
Canine keyhole limpet hemocyanin, KLH IgM antibody (KLH IgM Ab) ELISA Kit
MBS2615978-01 48 Well

Canine keyhole limpet hemocyanin, KLH IgM antibody (KLH IgM Ab) ELISA Kit

Sign In for Pricing
View Details
Canine keyhole limpet hemocyanin, KLH IgM antibody (KLH IgM Ab) ELISA Kit
MBS2615978-02 96 Well

Canine keyhole limpet hemocyanin, KLH IgM antibody (KLH IgM Ab) ELISA Kit

Sign In for Pricing
View Details
Canine keyhole limpet hemocyanin, KLH IgM antibody (KLH IgM Ab) ELISA Kit
MBS2615978-03 5x 96 Well

Canine keyhole limpet hemocyanin, KLH IgM antibody (KLH IgM Ab) ELISA Kit

Sign In for Pricing
View Details
Canine keyhole limpet hemocyanin, KLH IgM antibody (KLH IgM Ab) ELISA Kit
MBS2615978-04 10x 96 Well

Canine keyhole limpet hemocyanin, KLH IgM antibody (KLH IgM Ab) ELISA Kit

Sign In for Pricing
View Details
RNF125 Polyclonal Antibody, HRP Conjugated
bs-9250R-HRP 100 µL

RNF125 Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details