Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CENPL Rabbit Polyclonal Antibody (FITC)

CENPL Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

CENP-L, C1orf155, dJ383J4.3

UniProt

Q8N0S6

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human CENPL

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: AVEVGEDFNIKVIFSTLLGMKGTQRDPEAFLVQIVSKSQLPSENREGKVL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_201576

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KANK2 (KN Motif and Ankyrin Repeat Domain-Containing Protein 2, KN Motif and Ankyrin Repeat Domains 2)
483868 100 µL

KANK2 (KN Motif and Ankyrin Repeat Domain-Containing Protein 2, KN Motif and Ankyrin Repeat Domains 2)

Sign In for Pricing
View Details
Imvotamab Biosimilar - Anti-CD3E; MS4A1 mAb - Research Grade
PX-TA1848-01 50 µg

Imvotamab Biosimilar - Anti-CD3E; MS4A1 mAb - Research Grade

Sign In for Pricing
View Details
Imvotamab Biosimilar - Anti-CD3E; MS4A1 mAb - Research Grade
PX-TA1848-02 100 µg

Imvotamab Biosimilar - Anti-CD3E; MS4A1 mAb - Research Grade

Sign In for Pricing
View Details
Imvotamab Biosimilar - Anti-CD3E; MS4A1 mAb - Research Grade
PX-TA1848-03 1 mg

Imvotamab Biosimilar - Anti-CD3E; MS4A1 mAb - Research Grade

Sign In for Pricing
View Details
ITGB1BP2, CT (ITGB1BP2, Integrin beta-1-binding protein 2, Melusin) (PE) discontinued
037145-PE 200 µL

ITGB1BP2, CT (ITGB1BP2, Integrin beta-1-binding protein 2, Melusin) (PE) discontinued

Sign In for Pricing
View Details
Human Low-density lipoprotein receptor-related protein 2 (LRP2) ELISA Kit
AE35175HU-01 48 Tests

Human Low-density lipoprotein receptor-related protein 2 (LRP2) ELISA Kit

Sign In for Pricing
View Details