Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CENPT Rabbit Polyclonal Antibody (Biotin)

CENPT Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

SSMGA, CENP-T, C16orf56

UniProt

Q96BT3

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human CENPT

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: VRHPPRPRTTGPRPRQDPHKAGLSHYVKLFSFYAKMPMERKALEMVEKCL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

60kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_079358

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAP Kinase Substrate 1 (MKS1) discontinued
368573 200 µL

MAP Kinase Substrate 1 (MKS1) discontinued

Sign In for Pricing
View Details
Canine Anti-Presynaptic Membrane Receptor Antibody ELISA Kit
MBS752482-01 48 Well

Canine Anti-Presynaptic Membrane Receptor Antibody ELISA Kit

Sign In for Pricing
View Details
Canine Anti-Presynaptic Membrane Receptor Antibody ELISA Kit
MBS752482-02 96 Well

Canine Anti-Presynaptic Membrane Receptor Antibody ELISA Kit

Sign In for Pricing
View Details
Canine Anti-Presynaptic Membrane Receptor Antibody ELISA Kit
MBS752482-03 5x 96 Well

Canine Anti-Presynaptic Membrane Receptor Antibody ELISA Kit

Sign In for Pricing
View Details
Canine Anti-Presynaptic Membrane Receptor Antibody ELISA Kit
MBS752482-04 10x 96 Well

Canine Anti-Presynaptic Membrane Receptor Antibody ELISA Kit

Sign In for Pricing
View Details
MMP9 Rabbit mAb
F0008-20ul 20 µL

MMP9 Rabbit mAb

Sign In for Pricing
View Details