Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLEC18B Rabbit Polyclonal Antibody (HRP)

CLEC18B Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MRCL2

UniProt

Q8NCF0

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human CLEC18B

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DLRIDGDCFMVSSEADTYYRARMKCQRKGGVLAQIKSQKVQDILAFYLGR

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

49kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001011880

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pyroglutamate Aminopeptidase, Pyrococcus furiosus
orb3180889-01 50 mg

Pyroglutamate Aminopeptidase, Pyrococcus furiosus

Sign In for Pricing
View Details
Pyroglutamate Aminopeptidase, Pyrococcus furiosus
orb3180889-02 10 mg

Pyroglutamate Aminopeptidase, Pyrococcus furiosus

Sign In for Pricing
View Details
Rgs5 sgRNA CRISPR Lentivector set (Mouse)
K3770501 3x 1.0 µg

Rgs5 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
SUCLG2, Recombinant, Human, aa49-423, His-SUMO-Tag (Succinyl-CoA Ligase [GDP-forming] Subunit beta, Mitochondrial)
375459-01 20 µg

SUCLG2, Recombinant, Human, aa49-423, His-SUMO-Tag (Succinyl-CoA Ligase [GDP-forming] Subunit beta, Mitochondrial)

Sign In for Pricing
View Details
SUCLG2, Recombinant, Human, aa49-423, His-SUMO-Tag (Succinyl-CoA Ligase [GDP-forming] Subunit beta, Mitochondrial)
375459-02 100 µg

SUCLG2, Recombinant, Human, aa49-423, His-SUMO-Tag (Succinyl-CoA Ligase [GDP-forming] Subunit beta, Mitochondrial)

Sign In for Pricing
View Details
SUCLG2, Recombinant, Human, aa49-423, His-SUMO-Tag (Succinyl-CoA Ligase [GDP-forming] Subunit beta, Mitochondrial)
375459-03 1 mg

SUCLG2, Recombinant, Human, aa49-423, His-SUMO-Tag (Succinyl-CoA Ligase [GDP-forming] Subunit beta, Mitochondrial)

Sign In for Pricing
View Details