Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CNOT10 Rabbit Polyclonal Antibody (FITC)

CNOT10 Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

Q9H9A5

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human CNOT10

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: NVTDVSLGISSNEQDQGSDKGENEAMESSGKRAPQCYPSSVNSARTVMLF

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

79kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPARGC (PPARGC1A, LEM6, PGC1, PGC1A, PPARGC1, Peroxisome proliferator-activated receptor gamma coactivator 1-alpha, Ligand effect modulator 6) (MaxLight 490)
MBS6336165-01 0.1 mL

PPARGC (PPARGC1A, LEM6, PGC1, PGC1A, PPARGC1, Peroxisome proliferator-activated receptor gamma coactivator 1-alpha, Ligand effect modulator 6) (MaxLight 490)

Sign In for Pricing
View Details
PPARGC (PPARGC1A, LEM6, PGC1, PGC1A, PPARGC1, Peroxisome proliferator-activated receptor gamma coactivator 1-alpha, Ligand effect modulator 6) (MaxLight 490)
MBS6336165-02 5x 0.1 mL

PPARGC (PPARGC1A, LEM6, PGC1, PGC1A, PPARGC1, Peroxisome proliferator-activated receptor gamma coactivator 1-alpha, Ligand effect modulator 6) (MaxLight 490)

Sign In for Pricing
View Details
Dat-1 Antibody
orb801343 2 mg

Dat-1 Antibody

Sign In for Pricing
View Details
Anti-zebrafish Mlh1 Antibody, APC Conjugate
DZ41058-APC 200 µL/Vial

Anti-zebrafish Mlh1 Antibody, APC Conjugate

Sign In for Pricing
View Details
Lentiviral mouse Defb14 shRNA (UAS) - Lentiviral mouse Defb14 shRNA (UAS, RFP) plasmid
GTR15200881 1 Vial

Lentiviral mouse Defb14 shRNA (UAS) - Lentiviral mouse Defb14 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
VU0364572
orb2564341-01 25 mg

VU0364572

Sign In for Pricing
View Details