Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COPZ1 Rabbit Polyclonal Antibody (HRP)

COPZ1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

COPZ, CGI-120, HSPC181, zeta-COP, zeta1-COP

UniProt

P61923

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human COPZ1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DEIVDGGVILESDPQQVVHRVALRGEDVPLTEQTVSQVLQSAKEQIKWSL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

20kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_057141

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NPDC-1 HDR Plasmid (h)
sc-412710-HDR 20 µg

NPDC-1 HDR Plasmid (h)

Sign In for Pricing
View Details
UT-A CRISPR Activation Plasmid (h)
sc-417705-ACT 20 µg

UT-A CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
Rabbit Polyclonal EMR1 Antibody [DyLight 755]
NBP3-06088IR 0.1 mL

Rabbit Polyclonal EMR1 Antibody [DyLight 755]

Sign In for Pricing
View Details
Lentiviral human ZNF322 sgRNA gene knockout kit - Lentiviral human ZNF322 sgRNA gene knockout kit (100)
GTR15377251 1 Vial

Lentiviral human ZNF322 sgRNA gene knockout kit - Lentiviral human ZNF322 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
Fgfr1op2 AAV siRNA Pooled Vector
20518164 1.0 µg

Fgfr1op2 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
MGAT4A (Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase A, GlcNAc-T IVa, GNT-IV, GnT-Iva, GnT-IVa, GNT-IVA, N-acetylglucosaminyltransferase IVa, N-glycosyl-oligosaccharide-glycoprotein N-acetylglucosaminyltransferase IVa, Mannosyl (alpha-1,3-) -glycoprotein beta-1,4-N-acetylglucosaminyltransferase, Isozyme A) (MaxLight 750) discontinued
129618-ML750 100 µL

MGAT4A (Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase A, GlcNAc-T IVa, GNT-IV, GnT-Iva, GnT-IVa, GNT-IVA, N-acetylglucosaminyltransferase IVa, N-glycosyl-oligosaccharide-glycoprotein N-acetylglucosaminyltransferase IVa, Mannosyl (alpha-1,3-) -glycoprotein beta-1,4-N-acetylglucosaminyltransferase, Isozyme A) (MaxLight 750) discontinued

Sign In for Pricing
View Details