Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CPSF4L Rabbit Polyclonal Antibody (FITC)

CPSF4L Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

A6NMK7

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human CPSF4L

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: EKDVEMQKGTGLLPFQGMDKSASAVCNFFTKGLCEKGKLCPFRHDRGEKM

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

20kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Human, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001123357

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CPOX Pre-designed siRNA Set A
SI003553A 1 Each

Human CPOX Pre-designed siRNA Set A

Sign In for Pricing
View Details
ARHGEF39 Antibody - N-terminal region : HRP (ARP69037_P050-HRP)
ARP69037_P050-HRP 100 µL

ARHGEF39 Antibody - N-terminal region : HRP (ARP69037_P050-HRP)

Sign In for Pricing
View Details
Mouse Tartrate resistant acid phosphatase 5b ELISA Kit
MBS727192-01 48 Well

Mouse Tartrate resistant acid phosphatase 5b ELISA Kit

Sign In for Pricing
View Details
Mouse Tartrate resistant acid phosphatase 5b ELISA Kit
MBS727192-02 96 Well

Mouse Tartrate resistant acid phosphatase 5b ELISA Kit

Sign In for Pricing
View Details
Mouse Tartrate resistant acid phosphatase 5b ELISA Kit
MBS727192-03 5x 96 Well

Mouse Tartrate resistant acid phosphatase 5b ELISA Kit

Sign In for Pricing
View Details
Mouse Tartrate resistant acid phosphatase 5b ELISA Kit
MBS727192-04 10x 96 Well

Mouse Tartrate resistant acid phosphatase 5b ELISA Kit

Sign In for Pricing
View Details