Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CPSF4L Rabbit Polyclonal Antibody (HRP)

CPSF4L Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

A6NMK7

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human CPSF4L

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EKDVEMQKGTGLLPFQGMDKSASAVCNFFTKGLCEKGKLCPFRHDRGEKM

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

20kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Human, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001123357

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

YubL Antibody
orb836929 2 mg

YubL Antibody

Sign In for Pricing
View Details
CXCL13, 23-109aa, Human, His tag, E Coli (Denatured)
MBS205398-01 0.02 mg

CXCL13, 23-109aa, Human, His tag, E Coli (Denatured)

Sign In for Pricing
View Details
CXCL13, 23-109aa, Human, His tag, E Coli (Denatured)
MBS205398-02 0.1 mg

CXCL13, 23-109aa, Human, His tag, E Coli (Denatured)

Sign In for Pricing
View Details
CXCL13, 23-109aa, Human, His tag, E Coli (Denatured)
MBS205398-03 5x 0.02 mg

CXCL13, 23-109aa, Human, His tag, E Coli (Denatured)

Sign In for Pricing
View Details
CXCL13, 23-109aa, Human, His tag, E Coli (Denatured)
MBS205398-04 5x 0.1 mg

CXCL13, 23-109aa, Human, His tag, E Coli (Denatured)

Sign In for Pricing
View Details
ADAR1 polyclonal antibody
BS70968-01 50 µL

ADAR1 polyclonal antibody

Sign In for Pricing
View Details