Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CSRNP2 Rabbit Polyclonal Antibody (Biotin)

CSRNP2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

C12orf2, PPP1R72, TAIP-12, C12orf22, FAM130A1

UniProt

Q9H175

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human CSRNP2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: EPENEDFHPSWSPSSLPFRTDNEEGCGMVKTSQQNEDRPPEDSSLELPLA

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

59kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Human, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_110436

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal Fetuin Antibody (110) [FITC]
NBP2-90643F 0.1 mL

Rabbit Monoclonal Fetuin Antibody (110) [FITC]

Sign In for Pricing
View Details
Bhlha15 (NM_010800) Mouse Tagged ORF Clone Lentiviral Particle
MR224224L4V 200 µL

Bhlha15 (NM_010800) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Rabbit Bifunctional UDP N acetylglucosamine 2 epimerase/N acetylmannosamine kinase (GNE) ELISA kit
GTR10379002 96 Well

Rabbit Bifunctional UDP N acetylglucosamine 2 epimerase/N acetylmannosamine kinase (GNE) ELISA kit

Sign In for Pricing
View Details
GOLGA8J (NM_001282472) Human Tagged ORF Clone
RG239153 10 µg

GOLGA8J (NM_001282472) Human Tagged ORF Clone

Sign In for Pricing
View Details
PDCD6 Human Gene Knockout Kit (CRISPR)
KN402030 1 Kit

PDCD6 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
GLRA1 (Glycine Receptor, alpha 1, MGC138878, MGC138879, STHE) (AP)
MBS6164089-01 0.1 mL

GLRA1 (Glycine Receptor, alpha 1, MGC138878, MGC138879, STHE) (AP)

Sign In for Pricing
View Details