Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CSRNP2 Rabbit Polyclonal Antibody (FITC)

CSRNP2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

C12orf2, PPP1R72, TAIP-12, C12orf22, FAM130A1

UniProt

Q9H175

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human CSRNP2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: EPENEDFHPSWSPSSLPFRTDNEEGCGMVKTSQQNEDRPPEDSSLELPLA

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

59kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Human, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_110436

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

APC Anti-Mouse CD119 Antibody
JOT21417F 25μg

APC Anti-Mouse CD119 Antibody

Sign In for Pricing
View Details
C-Met Recombinant Rabbit mAb, BF700 conjugated
orb3164328 100 µL

C-Met Recombinant Rabbit mAb, BF700 conjugated

Sign In for Pricing
View Details
Anti-DNA Antibody (567)
RGK23892 100 μg

Anti-DNA Antibody (567)

Sign In for Pricing
View Details
Lentiviral human OR52B6 sgRNA gene knockout kit - Lentiviral human OR52B6 sgRNA gene knockout kit (100)
GTR15371035 1 Vial

Lentiviral human OR52B6 sgRNA gene knockout kit - Lentiviral human OR52B6 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
Rat Ifi44l Pre-designed siRNA Set A
SI206559A 1 Each

Rat Ifi44l Pre-designed siRNA Set A

Sign In for Pricing
View Details
Human Interleukin 17A (IL-17A) Microsample Fast ELISA Kit
orb1806731-01 48 Tests

Human Interleukin 17A (IL-17A) Microsample Fast ELISA Kit

Sign In for Pricing
View Details