Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CSRNP2 Rabbit Polyclonal Antibody (Biotin)

CSRNP2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

C12orf2, PPP1R72, TAIP-12, C12orf22, FAM130A1

UniProt

Q9H175

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human CSRNP2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: PAALCKSEVGKTPTLEALLPEDCNPEEPENEDFHPSWSPSSLPFRTDNEE

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

59kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_110436

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ros1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K6762705 3x 1.0 µg

Ros1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
PHKG2 (Phosphorylase Kinase, gamma 2 (Testis), GSD9C) (MaxLight 650)
250070-ML650 100 µL

PHKG2 (Phosphorylase Kinase, gamma 2 (Testis), GSD9C) (MaxLight 650)

Sign In for Pricing
View Details
Recombinant Prochlorococcus marinus PKHD-type hydroxylase P9211_12561 (P9211_12561)
MBS1000463-01 0.02 mg (E-Coli)

Recombinant Prochlorococcus marinus PKHD-type hydroxylase P9211_12561 (P9211_12561)

Sign In for Pricing
View Details
Recombinant Prochlorococcus marinus PKHD-type hydroxylase P9211_12561 (P9211_12561)
MBS1000463-02 0.1 mg (E-Coli)

Recombinant Prochlorococcus marinus PKHD-type hydroxylase P9211_12561 (P9211_12561)

Sign In for Pricing
View Details
Recombinant Prochlorococcus marinus PKHD-type hydroxylase P9211_12561 (P9211_12561)
MBS1000463-03 0.02 mg (Yeast)

Recombinant Prochlorococcus marinus PKHD-type hydroxylase P9211_12561 (P9211_12561)

Sign In for Pricing
View Details
Recombinant Prochlorococcus marinus PKHD-type hydroxylase P9211_12561 (P9211_12561)
MBS1000463-04 0.1 mg (Yeast)

Recombinant Prochlorococcus marinus PKHD-type hydroxylase P9211_12561 (P9211_12561)

Sign In for Pricing
View Details