Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CT47B1 Rabbit Polyclonal Antibody (HRP)

CT47B1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CT47.13, CT47A13

UniProt

P0C2W7

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human CT47B1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PPEEAAEEKLTEEATEEPAAEEPTSEEAVAPEEVTKSQPEKWDEEAQDAA

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

31kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_001139190

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal Serpin F1/PEDF Antibody (013) [Alexa Fluor 647]
NBP2-89798AF647 0.1 mL

Rabbit Monoclonal Serpin F1/PEDF Antibody (013) [Alexa Fluor 647]

Sign In for Pricing
View Details
Pira2 (NM_011089) Mouse Tagged Lenti ORF Clone
MR214520L4 10 µg

Pira2 (NM_011089) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Recombinant Human VDAC1 protein, His-tagged
VDAC1-19H 25 µg

Recombinant Human VDAC1 protein, His-tagged

Sign In for Pricing
View Details
ELISA kit for Human Neuropeptide Y receptor type 4 (PPYR1)
KTE62346-01 48 Tests

ELISA kit for Human Neuropeptide Y receptor type 4 (PPYR1)

Sign In for Pricing
View Details
ELISA kit for Human Neuropeptide Y receptor type 4 (PPYR1)
KTE62346-02 96 Tests

ELISA kit for Human Neuropeptide Y receptor type 4 (PPYR1)

Sign In for Pricing
View Details
ELISA kit for Human Neuropeptide Y receptor type 4 (PPYR1)
KTE62346-03 5x 96 Well

ELISA kit for Human Neuropeptide Y receptor type 4 (PPYR1)

Sign In for Pricing
View Details