Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CWF19L1 Rabbit Polyclonal Antibody (HRP)

CWF19L1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

C19L1, hDrn1, SCAR17

UniProt

Q69YN2

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human CWF19L1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FPLQFGREVLASEAILNVPDKSDWRQCQISKEDEETLARRFRKDFEPYDF

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

26kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Porcine, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Distillate Fuel Oils Oxidation Stability Tester (accelerated method) BPTL-267
BPTL-267 1 Unit

Distillate Fuel Oils Oxidation Stability Tester (accelerated method) BPTL-267

Sign In for Pricing
View Details
ACTN3 (NM_001104) Human Over-expression Lysate
LY420205 100 µg

ACTN3 (NM_001104) Human Over-expression Lysate

Sign In for Pricing
View Details
Rat Vascular Endothelial Growth Factor B (VEGFB) ELISA Kit
RD-VEGFB-Ra-01 96 Tests

Rat Vascular Endothelial Growth Factor B (VEGFB) ELISA Kit

Sign In for Pricing
View Details
Rat Vascular Endothelial Growth Factor B (VEGFB) ELISA Kit
RD-VEGFB-Ra-02 48 Tests

Rat Vascular Endothelial Growth Factor B (VEGFB) ELISA Kit

Sign In for Pricing
View Details
p-SCN-Bn-DTPA Trihydrochloride Salt (>90%)
TRC-S200105-10MG 10 mg

p-SCN-Bn-DTPA Trihydrochloride Salt (>90%)

Sign In for Pricing
View Details
RSU1 Rabbit Polyclonal Antibody
TA370109 100 µL

RSU1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details