Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CT55 Rabbit Polyclonal Antibody (HRP)

CT55 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CXorf48, BJHCC20A

UniProt

Q8WUE5

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human CXorf48

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ALAFYGRTADPAERQGPQQQGLPQGDTQLTTVQGVVTSFCGDYGMIDESI

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

26kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_060333

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELISA Kit for Tissue Factor Pathway Inhibitor (TFPI)
TRV-0040748-01 24 Tests

ELISA Kit for Tissue Factor Pathway Inhibitor (TFPI)

Sign In for Pricing
View Details
ELISA Kit for Tissue Factor Pathway Inhibitor (TFPI)
TRV-0040748-02 48 Tests

ELISA Kit for Tissue Factor Pathway Inhibitor (TFPI)

Sign In for Pricing
View Details
ELISA Kit for Tissue Factor Pathway Inhibitor (TFPI)
TRV-0040748-03 96 Tests

ELISA Kit for Tissue Factor Pathway Inhibitor (TFPI)

Sign In for Pricing
View Details
ELISA Kit for Tissue Factor Pathway Inhibitor (TFPI)
TRV-0040748-04 5x 96 Tests

ELISA Kit for Tissue Factor Pathway Inhibitor (TFPI)

Sign In for Pricing
View Details
ELISA Kit for Tissue Factor Pathway Inhibitor (TFPI)
TRV-0040748-05 10x 96 Tests

ELISA Kit for Tissue Factor Pathway Inhibitor (TFPI)

Sign In for Pricing
View Details
Chemokine Like Factor Superfamily 5 (CKLFSF5) Guinea Pig ELISA Kit
C3827 96 Tests

Chemokine Like Factor Superfamily 5 (CKLFSF5) Guinea Pig ELISA Kit

Sign In for Pricing
View Details